Lineage for d3cfje2 (3cfj E:107-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028190Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2028191Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2028294Domain d3cfje2: 3cfj E:107-213 [156574]
    Other proteins in same PDB: d3cfja1, d3cfjb1, d3cfjb2, d3cfjc1, d3cfjd1, d3cfjd2, d3cfje1, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl1
    automated match to d1dn0a2
    complexed with gol, so4

Details for d3cfje2

PDB Entry: 3cfj (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form
PDB Compounds: (E:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfje2 b.1.1.2 (E:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3cfje2:

Click to download the PDB-style file with coordinates for d3cfje2.
(The format of our PDB-style files is described here.)

Timeline for d3cfje2: