SCOPe 2.01: Domain d3cfje1: 3cfj E:1-107

Lineage for d3cfje1 (3cfj E:1-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)

8. Domain d3cfje1: 3cfj E:1-107 [156573]
   Other proteins in same PDB: d3cfja2, d3cfjb1, d3cfjb2, d3cfjc2, d3cfjd1, d3cfjd2, d3cfje2, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl2
   automatically matched to d1g9ml1
   complexed with gol, so4

Details for d3cfje1

PDB Entry: 3cfj, 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form

PDB Compounds: (E:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfje1:

Sequence; same for both SEQRES and ATOM records:

>d3cfje1 b.1.1.1 (E:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

Timeline for d3cfje1:

• d3cfje1 first appeared in SCOP 1.75
  
• d3cfje1 appears in SCOPe 2.02
  
• d3cfje1 appears in the current release, SCOPe 2.08