| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (19 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
| Domain d3cfjc1: 3cfj C:1-106 [156569] Other proteins in same PDB: d3cfja2, d3cfjb1, d3cfjb2, d3cfjc2, d3cfjd1, d3cfjd2, d3cfje2, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl2 automated match to d1dn0a1 complexed with gol, so4 |
PDB Entry: 3cfj (more details), 2.6 Å
SCOPe Domain Sequences for d3cfjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfjc1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtklei
Timeline for d3cfjc1: