Lineage for d3cfjc1 (3cfj C:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288752Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 1288785Domain d3cfjc1: 3cfj C:1-107 [156569]
    Other proteins in same PDB: d3cfja2, d3cfjb1, d3cfjb2, d3cfjc2, d3cfjd1, d3cfjd2, d3cfje2, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl2
    automatically matched to d1g9ml1
    complexed with gol, so4

Details for d3cfjc1

PDB Entry: 3cfj (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form
PDB Compounds: (C:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfjc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

SCOPe Domain Coordinates for d3cfjc1:

Click to download the PDB-style file with coordinates for d3cfjc1.
(The format of our PDB-style files is described here.)

Timeline for d3cfjc1: