Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d3cfja2: 3cfj A:108-212 [156566] Other proteins in same PDB: d3cfja1, d3cfjb1, d3cfjb2, d3cfjc1, d3cfjd1, d3cfjd2, d3cfje1, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl1 automatically matched to d1g9ml2 complexed with gol, so4 |
PDB Entry: 3cfj (more details), 2.6 Å
SCOPe Domain Sequences for d3cfja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfja2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d3cfja2: