SCOPe 2.01: Domain d3cfja2: 3cfj A:108-212

Lineage for d3cfja2 (3cfj A:108-212)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d3cfja2: 3cfj A:108-212 [156566]
   Other proteins in same PDB: d3cfja1, d3cfjb1, d3cfjb2, d3cfjc1, d3cfjd1, d3cfjd2, d3cfje1, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl1
   automatically matched to d1g9ml2
   complexed with gol, so4

Details for d3cfja2

PDB Entry: 3cfj, 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form

PDB Compounds: (A:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfja2:

Sequence; same for both SEQRES and ATOM records:

>d3cfja2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3cfja2:

• d3cfja2 first appeared in SCOP 1.75
  
• d3cfja2 appears in SCOPe 2.02
  
• d3cfja2 appears in the current release, SCOPe 2.08