SCOPe 2.05: Domain d3cfja1: 3cfj A:1-106

Lineage for d3cfja1 (3cfj A:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3cfja1: 3cfj A:1-106 [156565]
   Other proteins in same PDB: d3cfja2, d3cfjb1, d3cfjb2, d3cfjc2, d3cfjd1, d3cfjd2, d3cfje2, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl2
   automated match to d1dn0a1
   complexed with gol, so4

Details for d3cfja1

PDB Entry: 3cfj, 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form

PDB Compounds: (A:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfja1:

Sequence; same for both SEQRES and ATOM records:

>d3cfja1 b.1.1.0 (A:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtklei

Timeline for d3cfja1:

• d3cfja1 first appeared in SCOP 1.75
  
• d3cfja1 appears in SCOPe 2.04
  
• d3cfja1 appears in SCOPe 2.06
  
• d3cfja1 appears in the current release, SCOPe 2.08