SCOPe 2.02: Domain d3cf5p1: 3cf5 P:8-134

Lineage for d3cf5p1 (3cf5 P:8-134)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries)
   Uniprot Q9RXJ7 8-134

8. Domain d3cf5p1: 3cf5 P:8-134 [156556]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR P:8-134
   protein/RNA complex; complexed with mg

Details for d3cf5p1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (P:) 50S ribosomal protein L22

SCOPe Domain Sequences for d3cf5p1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5p1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep
vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii
vaekgnk

Timeline for d3cf5p1:

• d3cf5p1 first appeared in SCOP 1.75
  
• d3cf5p1 appears in SCOPe 2.01
  
• d3cf5p1 appears in SCOPe 2.03
  
• d3cf5p1 appears in the current release, SCOPe 2.08