Lineage for d3cf5e1 (3cf5 E:83-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978336Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2978337Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2978338Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2978339Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2978343Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
    Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172
  8. 2978346Domain d3cf5e1: 3cf5 E:83-172 [156543]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR E:83-172
    protein/RNA complex; complexed with mg

Details for d3cf5e1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3cf5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5e1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
ytinlelrgvgfrakltgkalemnigyshpviieppagvtfavpeptridvsgidkqlvg
qvaanvrkvrkpdayhgkgvrfvgeqialk

SCOPe Domain Coordinates for d3cf5e1:

Click to download the PDB-style file with coordinates for d3cf5e1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5e1: