Lineage for d3cf531 (3cf5 3:2-64)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242290Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 2242291Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 2242292Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 2242293Protein Ribosomal protein L35p [143036] (3 species)
  7. 2242294Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 2242297Domain d3cf531: 3cf5 3:2-64 [156536]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR 3:2-64
    protein/RNA complex; complexed with mg

Details for d3cf531

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d3cf531:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf531 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d3cf531:

Click to download the PDB-style file with coordinates for d3cf531.
(The format of our PDB-style files is described here.)

Timeline for d3cf531: