SCOPe 2.01: Domain d3cdgj1: 3cdg J:59-179

Lineage for d3cdgj1 (3cdg J:59-179)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein CD94 [56440] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries)

8. Domain d3cdgj1: 3cdg J:59-179 [156519]
   Other proteins in same PDB: d3cdga1, d3cdga2, d3cdgb1, d3cdgc1, d3cdgc2, d3cdgd1
   automatically matched to d1b6ea_

Details for d3cdgj1

PDB Entry: 3cdg, 3.4 Å

PDB Description: Human CD94/NKG2A in complex with HLA-E

PDB Compounds: (J:) Natural killer cells antigen CD94

SCOPe Domain Sequences for d3cdgj1:

Sequence; same for both SEQRES and ATOM records:

>d3cdgj1 d.169.1.1 (J:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]}
cscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywig
lsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqql
i

Timeline for d3cdgj1:

• d3cdgj1 first appeared in SCOP 1.75
  
• d3cdgj1 appears in SCOPe 2.02
  
• d3cdgj1 appears in the current release, SCOPe 2.08