Lineage for d1b33b_ (1b33 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759890Protein Allophycocyanin beta subunit [88957] (3 species)
  7. 759891Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [88959] (1 PDB entry)
  8. 759892Domain d1b33b_: 1b33 B: [15650]
    Other proteins in same PDB: d1b33a_, d1b33c_, d1b33e_, d1b33h_, d1b33j_, d1b33l_, d1b33n_, d1b33o_

Details for d1b33b_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
PDB Compounds: (B:) allophycocyanin, beta chain

SCOP Domain Sequences for d1b33b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33b_ a.1.1.3 (B:) Allophycocyanin beta subunit {Cyanobacterium (Mastigocladus laminosus) [TaxId: 83541]}
mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls

SCOP Domain Coordinates for d1b33b_:

Click to download the PDB-style file with coordinates for d1b33b_.
(The format of our PDB-style files is described here.)

Timeline for d1b33b_: