Lineage for d3cd6q1 (3cd6 Q:1-95)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1468902Domain d3cd6q1: 3cd6 Q:1-95 [156490]
    Other proteins in same PDB: d3cd621, d3cd6b1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6p1, d3cd6r1, d3cd6s1, d3cd6y1, d3cd6z1
    automatically matched to d1w2bp_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd6q1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d3cd6q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6q1 i.1.1.2 (Q:1-95) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d3cd6q1:

Click to download the PDB-style file with coordinates for d3cd6q1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6q1: