SCOP 1.71: Domain d1allb_: 1all B:

Lineage for d1allb_ (1all B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Allophycocyanin beta subunit [88957] (3 species)

7. Species Spirulina platensis [TaxId:118562] [88958] (1 PDB entry)

8. Domain d1allb_: 1all B: [15648]
   Other proteins in same PDB: d1alla_
   complexed with ch3, cyc

Details for d1allb_

PDB Entry: 1all, 2.3 Å

PDB Description: allophycocyanin

SCOP Domain Sequences for d1allb_:

Sequence; same for both SEQRES and ATOM records:

>d1allb_ a.1.1.3 (B:) Allophycocyanin beta subunit {Spirulina platensis}
mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls

Timeline for d1allb_:

• d1allb_ first appeared (with stable ids) in SCOP 1.55
  
• d1allb_ appears in SCOP 1.69
  
• d1allb_ appears in SCOP 1.73
  
• d1allb_ appears in the current release, SCOPe 2.08