Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein Allophycocyanin beta subunit [88957] (3 species) |
Species Spirulina platensis [TaxId:118562] [88958] (1 PDB entry) |
Domain d1allb_: 1all B: [15648] Other proteins in same PDB: d1alla_ complexed with ch3, cyc |
PDB Entry: 1all (more details), 2.3 Å
SCOP Domain Sequences for d1allb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1allb_ a.1.1.3 (B:) Allophycocyanin beta subunit {Spirulina platensis} mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls
Timeline for d1allb_: