Lineage for d3cd6b1 (3cd6 B:1-337)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801391Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 801392Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 801393Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 801424Domain d3cd6b1: 3cd6 B:1-337 [156479]
    Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
    automatically matched to d1jj2b_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6b1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOP Domain Sequences for d3cd6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6b1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOP Domain Coordinates for d3cd6b1:

Click to download the PDB-style file with coordinates for d3cd6b1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6b1: