Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) |
Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
Protein Ribosomal protein L32e [52044] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
Domain d3ccvy1: 3ccv Y:95-236 [156474] Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvz1 automatically matched to d1jj2x_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccv (more details), 2.9 Å
SCOPe Domain Sequences for d3ccvy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccvy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d3ccvy1: