Lineage for d1alla_ (1all A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 209451Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
    oligomers of two different types of homologous subunits
    each subunit contains 2 additional helices at the N-terminus
    binds a chromophore
  6. 209452Protein Allophycocyanin [46537] (3 species)
  7. 209469Species Spirulina platensis [TaxId:118562] [46538] (1 PDB entry)
  8. 209470Domain d1alla_: 1all A: [15647]

Details for d1alla_

PDB Entry: 1all (more details), 2.3 Å

PDB Description: allophycocyanin

SCOP Domain Sequences for d1alla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alla_ a.1.1.3 (A:) Allophycocyanin {Spirulina platensis}
sivtksivnadaearylspgeldriksfvtsgerrvriaetmtgareriikqagdqlfgk
rpdvvspggnaygadmtatclrdldyylrlitygivagdvtpieeigvvgvremykslgt
pieaiaegvramksvatsllsgadaaeagsyfdyligams

SCOP Domain Coordinates for d1alla_:

Click to download the PDB-style file with coordinates for d1alla_.
(The format of our PDB-style files is described here.)

Timeline for d1alla_: