Lineage for d3ccvr1 (3ccv R:1-150)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1905952Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1905953Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1905954Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1905955Protein Ribosomal protein L22 [54845] (5 species)
  7. 1905993Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 1906014Domain d3ccvr1: 3ccv R:1-150 [156467]
    Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
    automatically matched to d1ffko_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvr1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d3ccvr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d3ccvr1:

Click to download the PDB-style file with coordinates for d3ccvr1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvr1: