Lineage for d3ccv31 (3ccv 3:1-92)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070598Domain d3ccv31: 3ccv 3:1-92 [156454]
    Other proteins in same PDB: d3ccv21, d3ccvb1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvp1, d3ccvr1, d3ccvs1, d3ccvy1, d3ccvz1
    automatically matched to d1w2b2_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccv31

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d3ccv31:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccv31 i.1.1.2 (3:1-92) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d3ccv31:

Click to download the PDB-style file with coordinates for d3ccv31.
(The format of our PDB-style files is described here.)

Timeline for d3ccv31: