SCOP 1.69: Domain d1cpck_: 1cpc K:

Lineage for d1cpck_ (1cpc K:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin alpha subunit [88933] (6 species)

7. Species Cyanobacterium (Fremyella diplosiphon) [TaxId:1197] [88937] (1 PDB entry)

8. Domain d1cpck_: 1cpc K: [15645]
   Other proteins in same PDB: d1cpcb_, d1cpcl_

Details for d1cpck_

PDB Entry: 1cpc, 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution

SCOP Domain Sequences for d1cpck_:

Sequence; same for both SEQRES and ATOM records:

>d1cpck_ a.1.1.3 (K:) Phycocyanin alpha subunit {Cyanobacterium (Fremyella diplosiphon)}
mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
tfdlspswyvealkyikanhglsgdpaveansyidyainals

Timeline for d1cpck_:

• d1cpck_ first appeared (with stable ids) in SCOP 1.55
  
• d1cpck_ appears in SCOP 1.67
  
• d1cpck_ appears in SCOP 1.71
  
• d1cpck_ appears in the current release, SCOPe 2.08