Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like [46532] (4 proteins) oligomers of two different types of homologous subunits each subunit contains 2 additional helices at the N-terminus binds a chromophore |
Protein Phycocyanin [46533] (5 species) |
Species Cyanobacterium (Fremyella diplosiphon) [TaxId:1197] [46536] (1 PDB entry) |
Domain d1cpck_: 1cpc K: [15645] |
PDB Entry: 1cpc (more details), 1.66 Å
SCOP Domain Sequences for d1cpck_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpck_ a.1.1.3 (K:) Phycocyanin {Cyanobacterium (Fremyella diplosiphon)} mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr tfdlspswyvealkyikanhglsgdpaveansyidyainals
Timeline for d1cpck_: