Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3ccuv1: 3ccu V:1-65 [156447] Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1 automatically matched to d1w2bu_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccuv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccuv1 i.1.1.2 (V:1-65) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d3ccuv1: