Lineage for d1cpcb_ (1cpc B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 276690Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 276756Protein Phycocyanin beta subunit [88940] (6 species)
  7. 276757Species Cyanobacterium (Fremyella diplosiphon) [TaxId:1197] [88943] (1 PDB entry)
  8. 276758Domain d1cpcb_: 1cpc B: [15644]
    Other proteins in same PDB: d1cpca_, d1cpck_

Details for d1cpcb_

PDB Entry: 1cpc (more details), 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution

SCOP Domain Sequences for d1cpcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpcb_ a.1.1.3 (B:) Phycocyanin beta subunit {Cyanobacterium (Fremyella diplosiphon)}
mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal
gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava

SCOP Domain Coordinates for d1cpcb_:

Click to download the PDB-style file with coordinates for d1cpcb_.
(The format of our PDB-style files is described here.)

Timeline for d1cpcb_: