Lineage for d1cpca_ (1cpc A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 350323Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 350348Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 350349Species Cyanobacterium (Fremyella diplosiphon) [TaxId:1197] [88937] (1 PDB entry)
  8. 350350Domain d1cpca_: 1cpc A: [15643]
    Other proteins in same PDB: d1cpcb_, d1cpcl_

Details for d1cpca_

PDB Entry: 1cpc (more details), 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution

SCOP Domain Sequences for d1cpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpca_ a.1.1.3 (A:) Phycocyanin alpha subunit {Cyanobacterium (Fremyella diplosiphon)}
mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
tfdlspswyvealkyikanhglsgdpaveansyidyainals

SCOP Domain Coordinates for d1cpca_:

Click to download the PDB-style file with coordinates for d1cpca_.
(The format of our PDB-style files is described here.)

Timeline for d1cpca_: