Lineage for d3ccu11 (3ccu 1:1-56)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971998Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1972027Domain d3ccu11: 3ccu 1:1-56 [156428]
    Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1
    automatically matched to d1w2bz_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccu11

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3ccu11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccu11 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3ccu11:

Click to download the PDB-style file with coordinates for d3ccu11.
(The format of our PDB-style files is described here.)

Timeline for d3ccu11: