Lineage for d3ccsw1 (3ccs W:1-154)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1468990Domain d3ccsw1: 3ccs W:1-154 [156424]
    Other proteins in same PDB: d3ccs21, d3ccsb1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsp1, d3ccsr1, d3ccss1, d3ccsy1, d3ccsz1
    automatically matched to d1w2bv_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsw1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d3ccsw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsw1 i.1.1.2 (W:1-154) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d3ccsw1:

Click to download the PDB-style file with coordinates for d3ccsw1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsw1: