Lineage for d3ccsu1 (3ccs U:4-56)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249616Domain d3ccsu1: 3ccs U:4-56 [156422]
    Other proteins in same PDB: d3ccs21, d3ccsb1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsp1, d3ccsr1, d3ccss1, d3ccsy1, d3ccsz1
    automatically matched to d1w2bt_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsu1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3ccsu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsu1 i.1.1.2 (U:4-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d3ccsu1:

Click to download the PDB-style file with coordinates for d3ccsu1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsu1: