Lineage for d3ccst1 (3ccs T:1-119)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897344Domain d3ccst1: 3ccs T:1-119 [156421]
    Other proteins in same PDB: d3ccs21, d3ccsb1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsp1, d3ccsr1, d3ccss1, d3ccsy1, d3ccsz1
    automatically matched to d1w2bs_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccst1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d3ccst1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccst1 i.1.1.2 (T:1-119) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d3ccst1:

Click to download the PDB-style file with coordinates for d3ccst1.
(The format of our PDB-style files is described here.)

Timeline for d3ccst1: