Lineage for d1phnb_ (1phn B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759956Protein Phycocyanin beta subunit [88940] (6 species)
  7. 759960Species Red alga (Cyanidium caldarium) [TaxId:2771] [88941] (1 PDB entry)
  8. 759961Domain d1phnb_: 1phn B: [15642]
    Other proteins in same PDB: d1phna_
    complexed with cyc

Details for d1phnb_

PDB Entry: 1phn (more details), 1.65 Å

PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
PDB Compounds: (B:) phycocyanin

SCOP Domain Sequences for d1phnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phnb_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Cyanidium caldarium) [TaxId: 2771]}
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq

SCOP Domain Coordinates for d1phnb_:

Click to download the PDB-style file with coordinates for d1phnb_.
(The format of our PDB-style files is described here.)

Timeline for d1phnb_: