SCOP 1.69: Domain d1phnb_: 1phn B:

Lineage for d1phnb_ (1phn B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin beta subunit [88940] (6 species)

7. Species Red alga (Cyanidium caldarium) [TaxId:2771] [88941] (1 PDB entry)

8. Domain d1phnb_: 1phn B: [15642]
   Other proteins in same PDB: d1phna_

Details for d1phnb_

PDB Entry: 1phn, 1.65 Å

PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution

SCOP Domain Sequences for d1phnb_:

Sequence; same for both SEQRES and ATOM records:

>d1phnb_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Cyanidium caldarium)}
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq

Timeline for d1phnb_:

• d1phnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1phnb_ appears in SCOP 1.67
  
• d1phnb_ appears in SCOP 1.71
  
• d1phnb_ appears in the current release, SCOPe 2.08