Lineage for d1phna_ (1phn A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 437130Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 437155Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 437159Species Red alga (Cyanidium caldarium) [TaxId:2771] [88934] (1 PDB entry)
  8. 437160Domain d1phna_: 1phn A: [15641]
    Other proteins in same PDB: d1phnb_

Details for d1phna_

PDB Entry: 1phn (more details), 1.65 Å

PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution

SCOP Domain Sequences for d1phna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phna_ a.1.1.3 (A:) Phycocyanin alpha subunit {Red alga (Cyanidium caldarium)}
mktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaerlingaaqavy
skfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinr
tfdlspswyvealnyikanhglsgqaaneantyidyainals

SCOP Domain Coordinates for d1phna_:

Click to download the PDB-style file with coordinates for d1phna_.
(The format of our PDB-style files is described here.)

Timeline for d1phna_: