SCOPe 2.01: Domain d1ewab_: 1ewa B:

Lineage for d1ewab_ (1ewa B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)

8. Domain d1ewab_: 1ewa B: [15640]
   complexed with hem, iol, so4

Details for d1ewab_

PDB Entry: 1ewa, 2.5 Å

PDB Description: Dehaloperoxidase and 4-iodophenol

PDB Compounds: (B:) dehaloperoxidase

SCOPe Domain Sequences for d1ewab_:

Sequence; same for both SEQRES and ATOM records:

>d1ewab_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d1ewab_:

• d1ewab_ first appeared (with stable ids) in SCOP 1.55
  
• d1ewab_ appears in SCOP 1.75
  
• d1ewab_ appears in SCOPe 2.02
  
• d1ewab_ appears in the current release, SCOPe 2.08