Lineage for d1ewab_ (1ewa B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 43983Protein Dehaloperoxidase [46530] (1 species)
  7. 43984Species Marine worm (Amphitrite ornata) [46531] (2 PDB entries)
  8. 43988Domain d1ewab_: 1ewa B: [15640]

Details for d1ewab_

PDB Entry: 1ewa (more details), 2.5 Å

PDB Description: Dehaloperoxidase and 4-iodophenol

SCOP Domain Sequences for d1ewab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewab_ a.1.1.2 (B:) Dehaloperoxidase {Marine worm (Amphitrite ornata)}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOP Domain Coordinates for d1ewab_:

Click to download the PDB-style file with coordinates for d1ewab_.
(The format of our PDB-style files is described here.)

Timeline for d1ewab_: