Lineage for d3ccr31 (3ccr 3:1-92)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1468993Domain d3ccr31: 3ccr 3:1-92 [156382]
    Other proteins in same PDB: d3ccr21, d3ccrb1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrp1, d3ccrr1, d3ccrs1, d3ccry1, d3ccrz1
    automatically matched to d1w2b2_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccr31

PDB Entry: 3ccr (more details), 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d3ccr31:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccr31 i.1.1.2 (3:1-92) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d3ccr31:

Click to download the PDB-style file with coordinates for d3ccr31.
(The format of our PDB-style files is described here.)

Timeline for d3ccr31: