SCOPe 2.01: Domain d3ccr21: 3ccr 2:1-49

Lineage for d3ccr21 (3ccr 2:1-49)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d3ccr21: 3ccr 2:1-49 [156381]
   Other proteins in same PDB: d3ccr11, d3ccr31, d3ccrb1, d3ccrd1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrj1, d3ccrk1, d3ccrl1, d3ccrn1, d3ccro1, d3ccrp1, d3ccrq1, d3ccrr1, d3ccrs1, d3ccrt1, d3ccru1, d3ccrv1, d3ccrw1, d3ccrx1, d3ccry1, d3ccrz1
   automatically matched to 1VQ4 2:1-49
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccr21

PDB Entry: 3ccr, 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3ccr21:

Sequence, based on SEQRES records:

>d3ccr21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d3ccr21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d3ccr21:

• d3ccr21 first appeared in SCOP 1.75
  
• d3ccr21 appears in SCOPe 2.02
  
• d3ccr21 appears in the current release, SCOPe 2.08