Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) automatically mapped to Pfam PF01780 |
Protein Ribosomal protein L37ae [57831] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries) Uniprot P60619 |
Domain d3ccqz1: 3ccq Z:35-106 [156379] Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1 automatically matched to d1s72z_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccq (more details), 2.9 Å
SCOPe Domain Sequences for d3ccqz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccqz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]} sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk petpggktvrrs
Timeline for d3ccqz1: