SCOPe 2.01: Domain d3ccqi1: 3ccq I:66-129

Lineage for d3ccqi1 (3ccq I:66-129)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3ccqi1: 3ccq I:66-129 [156363]
   Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1, d3ccqz1
   automatically matched to d1s72i_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccqi1

PDB Entry: 3ccq, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3ccqi1:

Sequence; same for both SEQRES and ATOM records:

>d3ccqi1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3ccqi1:

• d3ccqi1 first appeared in SCOP 1.75
  
• d3ccqi1 appears in SCOPe 2.02
  
• d3ccqi1 appears in the current release, SCOPe 2.08