Lineage for d3ccqb1 (3ccq B:1-337)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126852Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 1126853Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1126894Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 1126927Domain d3ccqb1: 3ccq B:1-337 [156359]
    Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1, d3ccqz1
    automatically matched to d1jj2b_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccqb1

PDB Entry: 3ccq (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d3ccqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccqb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d3ccqb1:

Click to download the PDB-style file with coordinates for d3ccqb1.
(The format of our PDB-style files is described here.)

Timeline for d3ccqb1: