SCOP 1.57: Domain d1cqxa1: 1cqx A:1-150

Lineage for d1cqxa1 (1cqx A:1-150)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Flavohemoglobin, N-terminal domain [46528] (1 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [46529] (1 PDB entry)

8. Domain d1cqxa1: 1cqx A:1-150 [15635]
   Other proteins in same PDB: d1cqxa2, d1cqxa3, d1cqxb2, d1cqxb3

Details for d1cqxa1

PDB Entry: 1cqx, 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

SCOP Domain Sequences for d1cqxa1:

Sequence; same for both SEQRES and ATOM records:

>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

Timeline for d1cqxa1:

• d1cqxa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cqxa1 appears in SCOP 1.59
  
• d1cqxa1 appears in the current release, SCOPe 2.08