Lineage for d3ccmr1 (3ccm R:1-150)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203503Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1203504Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1203505Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1203506Protein Ribosomal protein L22 [54845] (5 species)
  7. 1203544Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 1203558Domain d3ccmr1: 3ccm R:1-150 [156347]
    Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
    automatically matched to d1ffko_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmr1

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d3ccmr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccmr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d3ccmr1:

Click to download the PDB-style file with coordinates for d3ccmr1.
(The format of our PDB-style files is described here.)

Timeline for d3ccmr1: