SCOP 1.73: Domain d3vhbb_: 3vhb B:

Lineage for d3vhbb_ (3vhb B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)

8. Domain d3vhbb_: 3vhb B: [15634]
   complexed with hem, imd

Details for d3vhbb_

PDB Entry: 3vhb, 2.1 Å

PDB Description: imidazole adduct of the bacterial hemoglobin from vitreoscilla sp.

PDB Compounds: (B:) protein (hemoglobin)

SCOP Domain Sequences for d3vhbb_:

Sequence, based on SEQRES records:

>d3vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records):

>d3vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

Timeline for d3vhbb_:

• d3vhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d3vhbb_ appears in SCOP 1.71
  
• d3vhbb_ appears in SCOP 1.75
  
• d3vhbb_ appears in the current release, SCOPe 2.08