Lineage for d3vhbb_ (3vhb B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 15Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 16Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 24Domain d3vhbb_: 3vhb B: [15634]

Details for d3vhbb_

PDB Entry: 3vhb (more details), 2.1 Å

PDB Description: imidazole adduct of the bacterial hemoglobin from vitreoscilla sp.

SCOP Domain Sequences for d3vhbb_:

Sequence, based on SEQRES records: (download)

>d3vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d3vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

SCOP Domain Coordinates for d3vhbb_:

Click to download the PDB-style file with coordinates for d3vhbb_.
(The format of our PDB-style files is described here.)

Timeline for d3vhbb_: