Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (4 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Ribosomal protein L7ae [55319] (7 species) |
Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
Domain d3ccmf1: 3ccm F:1-119 [156337] Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1 automatically matched to d1s72f_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccm (more details), 2.55 Å
SCOPe Domain Sequences for d3ccmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccmf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d3ccmf1: