Lineage for d4vhbb_ (4vhb B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 15Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 16Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 22Domain d4vhbb_: 4vhb B: [15632]

Details for d4vhbb_

PDB Entry: 4vhb (more details), 1.8 Å

PDB Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.

SCOP Domain Sequences for d4vhbb_:

Sequence, based on SEQRES records: (download)

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqav

SCOP Domain Coordinates for d4vhbb_:

Click to download the PDB-style file with coordinates for d4vhbb_.
(The format of our PDB-style files is described here.)

Timeline for d4vhbb_: