Lineage for d4vhba_ (4vhb A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93464Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 93465Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 93470Domain d4vhba_: 4vhb A: [15631]

Details for d4vhba_

PDB Entry: 4vhb (more details), 1.8 Å

PDB Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.

SCOP Domain Sequences for d4vhba_:

Sequence, based on SEQRES records: (download)

>d4vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
awgkaygviadvfiqveadlyaqave

Sequence, based on observed residues (ATOM records): (download)

>d4vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqave

SCOP Domain Coordinates for d4vhba_:

Click to download the PDB-style file with coordinates for d4vhba_.
(The format of our PDB-style files is described here.)

Timeline for d4vhba_: