Lineage for d3ccl21 (3ccl 2:1-49)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778338Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 778339Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 778340Protein Ribosomal protein L39e [48664] (1 species)
  7. 778341Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 778360Domain d3ccl21: 3ccl 2:1-49 [156309]
    Other proteins in same PDB: d3ccl11, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1
    automatically matched to 1VQ4 2:1-49
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccl21

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOP Domain Sequences for d3ccl21:

Sequence, based on SEQRES records: (download)

>d3ccl21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3ccl21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOP Domain Coordinates for d3ccl21:

Click to download the PDB-style file with coordinates for d3ccl21.
(The format of our PDB-style files is described here.)

Timeline for d3ccl21: