Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries) Uniprot P10970 |
Domain d3ccjr1: 3ccj R:1-150 [156299] Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1 automatically matched to d1ffko_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3ccj (more details), 2.7 Å
SCOP Domain Sequences for d3ccjr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccjr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d3ccjr1: