Lineage for d2vhba_ (2vhb A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93464Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 93465Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 93468Domain d2vhba_: 2vhb A: [15629]

Details for d2vhba_

PDB Entry: 2vhb (more details), 1.76 Å

PDB Description: azide adduct of the bacterial hemoglobin from vitreoscilla stercoraria

SCOP Domain Sequences for d2vhba_:

Sequence, based on SEQRES records: (download)

>d2vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqave

Sequence, based on observed residues (ATOM records): (download)

>d2vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqnie
nlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvi
advfiqveadlyaqave

SCOP Domain Coordinates for d2vhba_:

Click to download the PDB-style file with coordinates for d2vhba_.
(The format of our PDB-style files is described here.)

Timeline for d2vhba_: