SCOPe 2.01: Domain d3ccey1: 3cce Y:95-236

Lineage for d3ccey1 (3cce Y:95-236)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d3ccey1: 3cce Y:95-236 [156282]
   Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccez1
   automatically matched to d1jj2x_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccey1

PDB Entry: 3cce, 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccey1:

Sequence; same for both SEQRES and ATOM records:

>d3ccey1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d3ccey1:

• d3ccey1 first appeared in SCOP 1.75
  
• d3ccey1 appears in SCOPe 2.02
  
• d3ccey1 appears in the current release, SCOPe 2.08